Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G154700.1
Common NamePOPTR_0002s15610g
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 821aa    MW: 89297.3 Da    PI: 6.2784
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G154700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
                         688999***********************************************999 PP

               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela++a++elvk+++ +ep+W  s     e++n + +l++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    +
                         5899******************9999****************999899******************************.************ PP

               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksngh 161
                          +t++vi sg      g lqlm+ael +lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +   + +v +++lpSg+++++++ng+
                         ****************************************************************999999********************* PP

               START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         skvtwveh+ +++r++h+l+r++++sg+ +ga++w atlqrqce+
                         *******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.216114174IPR001356Homeobox domain
SMARTSM003891.7E-17115178IPR001356Homeobox domain
CDDcd000862.03E-18116174No hitNo description
PfamPF000462.2E-18117172IPR001356Homeobox domain
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
PROSITE profilePS5084843.275317554IPR002913START domain
SuperFamilySSF559613.3E-32319551No hitNo description
CDDcd088759.57E-122321550No hitNo description
PfamPF018524.3E-53326551IPR002913START domain
SMARTSM002346.5E-44326551IPR002913START domain
SuperFamilySSF559611.65E-22579813No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301331.20.0homeodomain family protein
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9GPV90.0B9GPV9_POPTR; Homeodomain family protein
STRINGPOPTR_0002s15610.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein